Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MDKYIDDHFERLEKALSNLIDSVAKYHPSVGHAEELKAADIDLSKGLEKVEEHQNNYLRIQKLRQSSALLDTQIRDTLTSLANARKDIVTTQTTTYPSEPNYPIAYEELLSYAQRISKTTLPPAATLESAGMTLDTRTQTHAQAPTPNPEPQPLPALGPSAPTPPLSQSPAMNDTPTVASDQPTQQSTASTNISLPENLGQYINPLSGQSFFPWPMEASIRTGALASYQMLLERGVDPAGYDPALEEERKRKEEEERKAMEEQEQAEREARERQLREERERLRLERERQREREQEAWRRASLVGGETDGPAPPRPPAGTAVRKQFQFTNLDDLDDDDDDDDDE |
Length | 343 |
Position | Middle |
Organism | Claviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Clavicipitaceae> Claviceps. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.999 |
Instability index | 49.43 |
Isoelectric point | 4.69 |
Molecular weight | 38619.02 |
Publications | PubMed=23468653 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30743 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 79.43| 25| 28| 245| 270| 1 --------------------------------------------------------------------------- 245- 270 (38.35/27.29) LEEERKR.KEEEERKAMEEQEqAEREA 275- 300 (41.09/24.58) LREERERlRLERERQREREQE.AWRRA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.40| 16| 24| 8| 23| 2 --------------------------------------------------------------------------- 8- 23 (26.89/20.56) HFERLEKA...LSNLIDSV 32- 50 (20.51/14.06) HAEELKAAdidLSKGLEKV --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 95.52| 23| 24| 114| 136| 3 --------------------------------------------------------------------------- 94- 111 (23.70/ 9.75) .......TTYPSEPNYPIAYEELLS 114- 136 (36.27/18.90) QRISK..TTLPPAATLESAGMTLDT 139- 163 (35.55/18.38) QTHAQapTPNPEPQPLPALGPSAPT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) PRPPAGTAVRKQFQFTNLDDLDDDDDDDDDE 2) WRRASLVGGET | 313 297 | 343 307 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab