<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30734
Description |
Related to cyclin-dependent kinase chain SRB10 |
Sequence | MPMRPRAGAQYPHSSSSSNLGLQNYRRYGETQERLGAFVPRIRVMDRYRIVGFISSGTYGRVYKAVSRVNVIAARSKVGTAAGGSGNSGGSGGGIGQEVAIKKFKPDKEGEQVSYTGISQSAIREMSLCSELSHENVIQLVETILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPATVKSIMFQLLNGCQYLHTNWILHRDLKPANIMVTSGGEVKIGDLGLARRFDKPLHPLFSGDKVVVTIWYRAPELILGSYHYTPAIDLWAVGCIFAELLSLRPIFKGEEAKMDGKKTVPFQRNQMQKIVDIVGLPTKSRWPLLPMMPEFNQLSTLQAPPLVQSHSQQHHSSHHNSNSSDNNHSQQYLQSQHVNNSNSSYSSSNSSDGGGSSLTSNLEKWYNSTISNASPTGSGPSPTSLGPEGLKLLAGLLEYDPEKRLTAAQALQSNFFTEGDPASTNAFEGLKLEYPHRRVSQDDNDLRTSSSLPGTKRTGLADEMLRPNKRMKE |
Length | 505 |
Position | Kinase |
Organism | Claviceps purpurea (strain 20.1) (Ergot fungus) (Sphacelia segetum) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Clavicipitaceae> Claviceps.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.497 |
Instability index | 44.60 |
Isoelectric point | 9.02 |
Molecular weight | 55841.40 |
Publications | PubMed=23468653
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30734
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.21| 16| 32| 415| 444| 1
---------------------------------------------------------------------------
415- 436 (21.31/33.56) TSLGP......EGLKllaglLEYdPEKR
449- 470 (26.90/ 8.02) TEGDPastnafEGLK.....LEY.PHRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.92| 15| 17| 342| 356| 3
---------------------------------------------------------------------------
342- 356 (32.58/18.75) HSQQHHSSHH..NSNSS
360- 376 (26.35/13.87) HSQQYLQSQHvnNSNSS
---------------------------------------------------------------------------
|