| Description | Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MDSSKQNLNQVIYSIDKTLEILHQLSSFDVDVASHLNNLVFEIDNMAKLGENCHSIKVPMEVLNLIDNGKNPDEFARDLLNNCIAKNQITKGKVDAFKDLRGHLLEDLEHAFPDEVEDYRQRRI |
| Length | 124 |
| Position | Middle |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum. |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.480 |
| Instability index | 21.77 |
| Isoelectric point | 4.98 |
| Molecular weight | 14234.92 |
| Publications | PubMed=21743474 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
| GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP30729
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 97.22| 27| 27| 27| 53| 1
---------------------------------------------------------------------------
8- 25 (18.40/ 6.35) ...........LNQVIYSIDKTLE.ILHQL
27- 53 (45.79/22.64) SFDV..DVASHLNNLVFEIDNMAK.LGENC
55- 83 (33.03/15.05) SIKVpmEVLNLIDNGK.NPDEFARdLLNNC
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EFARDLLNNCIAKNQITKGKV 2) LNQVIYS 3) YRQRRI | 74 8 119 | 94 14 124 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab