<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30726
| Description |
Uncharacterized protein |
| Sequence | MVKNITHQSFILKYDSLRMIVLHPPTVIVQIKFIDSLSPLDKSMIKSMKEMYLSYLNDLYEKIAYKVQQSLPNERIEKLKMTLERIMLFLRLNKHDINLVHKERLLLVEKHISLFLSCKNLHKPTSSPLQGQLPQPSIHTSQEQDTYARQLPMLDSCGRDIASEFDRLLHLID |
| Length | 173 |
| Position | Tail |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.229 |
| Instability index | 59.82 |
| Isoelectric point | 9.02 |
| Molecular weight | 20297.70 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30726
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.60| 14| 24| 77| 90| 1
---------------------------------------------------------------------------
77- 90 (23.75/16.03) EKLKMTLERIMLFL
103- 116 (22.85/15.17) ERLLLVEKHISLFL
---------------------------------------------------------------------------
|