<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30713

Description Uncharacterized protein
SequenceMFGSRIHQSVATLDSNGGLSDEGTQNVFIPFKAYSARKRIVVKEIVIENTEASKGLLEYINSHSVSNIVLGASSRSTLGRKYWTHDVPTLVNKAAPEFCSVYVVSKGKQQSVRPAAKSLPSSVPARQPSSSAWSAPRSSNSGSEDSTRFSYMRSEQKIVESEKTRGEKGPSIVPIDNLHSPEMTNPYKHASQPDGNMRYARISPRSVDMTSENLDFTQVAIRETPMNGSSSYSVDAEMKRLKLELRQTMDMYNAACKEAVMANQAADELNKWKIEEARKFEQARFAEEAALAIAETEKAKCRAAIEAAKKAQKMAEIEAQRRKYAELKAKRETEKKKQAMNVRSQNDIRYRKYTIEEIEAATKKFSNAQKIGEGGYGPVFKGKLDHTPVAIKVLSPDAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPEYGCLVYELMNNGSLEDRLFRKGNTPSIPWEIRFKIAAEIATGLLFLHQSKPEPLVHRDLKPGNILLDKNYVCKISDVGLARLVPSSVADCVTQYHMTSAAGTFCYIDPEYQQTGRLETKSDIYSLGVMLLQIITARPPMGLTHHVERAIEKGKFADFLDPTVPNWPVEEALKFAKLSLKCAELRKKDRPDLGSVVVPELTRLSEFGMSSMPGIG
Length643
PositionTail
OrganismSolanum tuberosum (Potato)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
Aromaticity0.07
Grand average of hydropathy-0.458
Instability index46.04
Isoelectric point9.09
Molecular weight71532.02
Publications
PubMed=21743474

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:InterPro
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP30713
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     148.61|      45|     169|     214|     258|       1
---------------------------------------------------------------------------
  214-  258 (76.94/49.67)	LDFTQVAIRE.TPMNGSSSYSVDAEMKRLKLELRQTMDMYNAACKE
  384-  429 (71.68/45.81)	LDHTPVAIKVlSPDAAQGKKQFQQEVEVLSLIRHPNLVLLLGACPE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.62|      16|      18|     106|     121|       2
---------------------------------------------------------------------------
  106-  121 (26.32/16.34)	KGKQQSVRPAAKSLPS
  126-  141 (28.30/18.14)	RQPSSSAWSAPRSSNS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.63|      18|      96|     340|     380|       3
---------------------------------------------------------------------------
  305-  327 (25.13/35.11)	IEAAKK....AQKMAEieaqrRKYAEL
  358-  379 (27.50/19.55)	IEAATKkfsnAQKIGE.....GGYGPV
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP30713 with Med32 domain of Kingdom Viridiplantae

Unable to open file!