<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30710

Description Uncharacterized protein
SequenceMAKSEGKAIGIDLGTTYSCVGVWQNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPQNTVFDAKRLIGRRFSDPTVQADMKHWPFKVVPGPGDKPMIVVNFKNEEKQFAPEEISSMVLIKMKETAEAFLGQTVKNAVVTVPAYFNDSQRQATKDAGAIAGLNVMRIINEPTAAAIAYGLDKKASKNGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVSHFVQEFKRKHKKDITSNARALRRLRTACERAKRTLSSTSQTTIEVDSLYEGIDFYATITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSQVHDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTVLIPRNTTIPTKKEQIFSTYSDNQPAVLIQVYEGERSLTKDNNLLGKFELKGIPPAPRGVPQINVCFDIDANGILNVSAEDKTARVKNKITITNDKGRLSKEEIERMVEEAERYKSEDEAMKRKVEAKNALENYAYNMRNTIKDEKISGKLDPSEKQKIEKAVDETIEWLDRNQLAEVDEFEDKLKELEKLCNPIIGKMYQGGAGSDYGTGNSGAGPKIEEVD
Length639
PositionUnknown
OrganismSolanum tuberosum (Potato)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
Aromaticity0.06
Grand average of hydropathy-0.465
Instability index32.61
Isoelectric point5.42
Molecular weight70796.59
Publications
PubMed=21743474

Function

Annotated function 
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central

GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      95.73|      32|      41|     510|     547|       4
---------------------------------------------------------------------------
  510-  542 (45.60/28.40)	NDKGRLSKEEIERMVEEAERYKSEdEAMKRKVE
  553-  584 (50.13/33.16)	NMRNTIKDEKISGKLDPSEKQKIE.KAVDETIE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.00|      18|      21|      37|      54|       5
---------------------------------------------------------------------------
   15-   32 (19.59/ 9.39)	....TTYSCVGVWQNDRveIIP
   37-   54 (32.67/19.86)	NR..TTPSYVAFTDTER..LIG
   59-   77 (24.74/13.51)	NQvaMNPQNTVF.DAKR..LIG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30710 with Med37 domain of Kingdom Viridiplantae
Unable to open file!