<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30702
| Description |
Uncharacterized protein |
| Sequence | MDPDSKNFGRGPRELTGARDLISHFKLLPHYEFFGKRSLPLSISDTHYLHNVVGDTEIRKGEKMQLDQLTQDTSFSRETSSCIRPFDLDVLREAFQLRETAPVNLSPSDKGTPTIAGKSKSEMKDKEKKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKKDKSGHNDPGAEHSKKHEKKRKHDEEDLNGIHKHKKSKHRSSKIDEIGSIKVAG |
| Length | 220 |
| Position | Head |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.560 |
| Instability index | 41.13 |
| Isoelectric point | 9.66 |
| Molecular weight | 25475.44 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30702
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.71| 16| 16| 131| 146| 1
---------------------------------------------------------------------------
131- 146 (30.51/10.68) KKHK.KHKDKDKEKDKE
148- 164 (25.21/ 7.63) KKHKhRHKDRSKDKDKE
---------------------------------------------------------------------------
|