<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30700
Description |
Uncharacterized protein |
Sequence | MEDKGTVTSLKTIQELAVEGQKHLEDTIEAAHQILSAMNDELCNPSLWSTLNTAASSASASAAGGGVGASAVLSNGQQLHTNGDISSDTSSSSSASAQHLDIGGGALDESRLRYKSSIASLRSVLTAISNSQKAKALEAASASGSLSAADQAEIEQLEDRASSLKKELVDKNKHLKLLIDQLRDLLADLCTWQSPCST |
Length | 198 |
Position | Head |
Organism | Solanum tuberosum (Potato) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.266 |
Instability index | 36.11 |
Isoelectric point | 4.94 |
Molecular weight | 20594.54 |
Publications | PubMed=21743474
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30700
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.14| 11| 36| 56| 66| 1
---------------------------------------------------------------------------
56- 66 (21.24/11.57) SSASASA....AGGG
91- 105 (15.90/ 6.85) SSSSASAqhldIGGG
---------------------------------------------------------------------------
|