| Description | Uncharacterized protein |
| Sequence | MELDELRSILKNSSVDLWSLIDTAISVAILDHGNELRSRRDAIVEKLYAPLLSNNSNSDRNYEIPKKIERNIDDDHKFKIEEKSNEEDVEISKILRIKNHFEIPNQSENCLVDQLRSLAEMDINFKVLETTDIGRHVNKLRKHSSNEVRRLVKLLIRRWKDIVDEWVRLNTLVEDTAKIGRSSEVDLEDVGKPKNSVVANSISGFEAKYW |
| Length | 210 |
| Position | Unknown |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.611 |
| Instability index | 49.99 |
| Isoelectric point | 5.66 |
| Molecular weight | 24392.31 |
| Publications | PubMed=21743474 |
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats |
>MDP30697
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.49| 13| 14| 55| 67| 1
---------------------------------------------------------------------------
55- 67 (22.95/13.22) NSNSDRNYEIPKK
71- 83 (22.55/12.88) NIDDDHKFKIEEK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RNYEIPKK 2) RRDAIVEKLYAPLLS | 60 39 | 67 53 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab