<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30697
| Description |
Uncharacterized protein |
| Sequence | MELDELRSILKNSSVDLWSLIDTAISVAILDHGNELRSRRDAIVEKLYAPLLSNNSNSDRNYEIPKKIERNIDDDHKFKIEEKSNEEDVEISKILRIKNHFEIPNQSENCLVDQLRSLAEMDINFKVLETTDIGRHVNKLRKHSSNEVRRLVKLLIRRWKDIVDEWVRLNTLVEDTAKIGRSSEVDLEDVGKPKNSVVANSISGFEAKYW |
| Length | 210 |
| Position | Unknown |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.611 |
| Instability index | 49.99 |
| Isoelectric point | 5.66 |
| Molecular weight | 24392.31 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30697
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.49| 13| 14| 55| 67| 1
---------------------------------------------------------------------------
55- 67 (22.95/13.22) NSNSDRNYEIPKK
71- 83 (22.55/12.88) NIDDDHKFKIEEK
---------------------------------------------------------------------------
|