<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30690
Description |
Uncharacterized protein |
Sequence | MVGIKANRDFLSLSFELEQGETLSLVAHVDPEDIQGCISWWLVMGDGFSEENKLKMDVNSGESETRKFLGYLSLEVLYSTLMDMVSVSSTAGH |
Length | 93 |
Position | Head |
Organism | Solanum tuberosum (Potato) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.014 |
Instability index | 24.63 |
Isoelectric point | 4.36 |
Molecular weight | 10321.57 |
Publications | PubMed=21743474
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30690
No repeats found
No repeats found
|