<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30687
Description |
Uncharacterized protein |
Sequence | MDPDSKKFGRGPRELAGAVDLINHFKLLPHHEFFCKKPLPLSISDTRYLHNVVGDREIRKGEGMQLDQLICDTSSLKETNSRIQPFELDALNEAFQLREAAPIVLPPSEKGIPTVAGKSKSESKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKKDKTGHHDSGADHSTKHHEKRKMHDGKEDLNDVNKHKRNKHKS |
Length | 206 |
Position | Head |
Organism | Solanum tuberosum (Potato) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -1.517 |
Instability index | 34.17 |
Isoelectric point | 9.58 |
Molecular weight | 23848.74 |
Publications | PubMed=21743474
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP30687
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.83| 17| 21| 133| 153| 1
---------------------------------------------------------------------------
133- 153 (29.27/17.11) HKDKDKEKdkehKKHKHRHKD
155- 171 (31.56/10.25) SKDKDKEK....KKDKTGHHD
---------------------------------------------------------------------------
|