<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30686
| Description |
Uncharacterized protein |
| Sequence | MQLDQLICDTSSLKETNSRIQPFELDALNEAFQLREAAPIVLPPSEKGIPTVAGKSKSESKDKEKKHKKHKDKDKEKDKEHKKHKHRHKDRSKDKDKEKKKDKTGHHDSGADHSTKHHEKRKMHDGKEDLNDVNKHKRNKLKERNKNKTLAGKDILLLAQKYLASPVLFSNNSSRAS |
| Length | 177 |
| Position | Head |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -1.584 |
| Instability index | 47.95 |
| Isoelectric point | 9.75 |
| Molecular weight | 20401.86 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30686
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.41| 17| 21| 70| 90| 1
---------------------------------------------------------------------------
70- 90 (29.48/14.36) HKDKDKEKdkehKKHKHRHKD
92- 108 (30.93/ 8.39) SKDKDKEK....KKDKTGHHD
---------------------------------------------------------------------------
|