<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30681

Description Uncharacterized protein
SequenceMMEEKDGVVIKVEGLSALPLLNSSTIAVAINGKKMSKYVVKWALDKFVPEGKVCFKLLHVRPRIVGVPTPMGSFIPIAQVREDVVAAFRKDVEWQTSEKLLPYKMLCTNRKVQVEVLQLESDDIVNAIAQEITKLNIIKLVIGASSRSIFSRGQSLSSRISDSTPSFCTIYAVSKGKLLSVRPSNSEINGSSSAGDSYTSCSITSSTVHTSSSLTERSEPDSSSSYSHFRSPSLPMQRFRALSHINQNFPHRRACSNVSVHHNSLSLDFGDGEDDVRSCPQGTYLTDGDDLTSSFRSLTDINFELEKLRTELRHTRGMYAVAQTEVIDASRKINELHKRRLEEDVKLREICLKEEEVKELARKENEKYEAAKREADYVKECAEREAAQRKEAELLALREAKEKDKLENALTGQAHQYQEFTWEEIVSSTSSFDENLKIGMGGYGTVYKCSLHHTTVAVKVLHSEGSHLTKQYQQELEILSKISHPHLLILLGVCPDRGCLVYEFMENGSLEERLFRKHDTPPIPWFDRYRIAWEVASALAFLHNSKPNPVIHRDLKPANILLDRNFVSKIGDVGLSTMINLDAALSTIYKDTGPVGTLCYIDPEYQRTGLISPTSDIYAFGMVLLQLLTAKAAMGLPHIVETAIDKDNLTKVLDPEAGKWPIEETKKLAMLALKCTELYRRDRPDLKDEILPALEKLKEFADKTRDSASTTKSPPPNYFLCPLLKDIMKDPCVAADGFTYDRNAIETWLKEKDISPMTSLPLAHKNLLPNYALLSAILDWKSR
Length783
PositionTail
OrganismSolanum tuberosum (Potato)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
Aromaticity0.07
Grand average of hydropathy-0.344
Instability index42.74
Isoelectric point6.52
Molecular weight87960.61
Publications
PubMed=21743474

Function

Annotated function Functions as an E3 ubiquitin ligase. 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW
ubiquitin-protein transferase activity	GO:0004842	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30681
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.61|      28|      29|     348|     376|       1
---------------------------------------------------------------------------
  325-  343 (17.16/ 7.08)	........EVIDASRKINE..LHKRRLEE..
  348-  376 (41.87/34.46)	REiCLKEEEVKELARKENE..KYEAAKREAD
  379-  404 (33.58/21.87)	KE.CAEREAAQ...RKEAEllALREAK.EKD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      47.30|      17|      29|     186|     203|       2
---------------------------------------------------------------------------
  191-  209 (25.18/13.59)	SSSAGDSYTSCSI......tsSTVH
  222-  246 (22.13/ 6.63)	SSSSYSHFRSPSLpmqrfralSHIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     118.93|      36|     342|     103|     138|       4
---------------------------------------------------------------------------
  103-  138 (58.22/36.41)	YKMLCTNRKVQVEVLQLESDDIVNAIAQEITKLNII
  447-  482 (60.71/38.25)	YKCSLHHTTVAVKVLHSEGSHLTKQYQQELEILSKI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      99.67|      31|     315|     265|     324|       5
---------------------------------------------------------------------------
  279-  316 (45.07/70.23)	CPQgTYLTDGDDLTSsfrsltDINFELEKLRTELRHTR
  675-  705 (54.60/19.39)	CTE.LYRRDRPDLKD......EILPALEKLKEFADKTR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30681 with Med32 domain of Kingdom Viridiplantae
Unable to open file!