<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30679
Description |
Uncharacterized protein |
Sequence | MKDKSRFSVSLRSLSQPMSLKDIARTWDICTHVIIFEYAQQSGGGTFSSKYGWVLGELFECSMIKHDLMSQVMRLS |
Length | 76 |
Position | Tail |
Organism | Solanum tuberosum (Potato) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.091 |
Instability index | 57.77 |
Isoelectric point | 8.71 |
Molecular weight | 8695.02 |
Publications | PubMed=21743474
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30679
No repeats found
No repeats found
|