<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30677
| Description |
Uncharacterized protein |
| Sequence | MDIISQLQEQVNTIAALAFNTFGTLQRDAPPVRLSPNYPEPPPANPTEDSTNVAEQPKQMSAAFVKAAKQFDALVAALPLSDGGEEAQLKRIAELQAENDAVGQELQKQLEAAEKELKQVQELFNQATDNCLNLKKPE |
| Length | 138 |
| Position | Middle |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.537 |
| Instability index | 60.63 |
| Isoelectric point | 4.51 |
| Molecular weight | 15070.72 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
polar nucleus GO:0043078 IEA:EnsemblPlants
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | defense response to fungus GO:0050832 IEA:EnsemblPlants
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30677
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 93.28| 26| 27| 72| 97| 1
---------------------------------------------------------------------------
44- 67 (18.14/ 7.68) .....ANPTEDSTNVAeQPKQMsaAFV..KA
72- 97 (41.57/26.06) DALVAALPLSDGGEEA.QLKRI..AEL..QA
100- 127 (33.57/19.78) DAVGQELQKQLEAAEK.ELKQV..QELfnQA
---------------------------------------------------------------------------
|