<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30651
Description |
Uncharacterized protein |
Sequence | MDSGDWRTQLLPDLRQRIGNMIMETLKRHVSVSGQERVQELKEIAVTFEEKIYPTATSQQDYLQKISSKMLIVETRRSQNLIQPNPASSRQNALGQGSHNMQSQVNSQAQQLPVPTVANQTQTRQPLLQQNLQNNMASTGLQNSASLAPALPSVSNLTQGTMPNVLGQN |
Length | 169 |
Position | Tail |
Organism | Solanum tuberosum (Potato) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.651 |
Instability index | 65.74 |
Isoelectric point | 9.59 |
Molecular weight | 18733.90 |
Publications | PubMed=21743474
|
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | chromatin DNA binding GO:0031490 IEA:InterPro
transcription coactivator activity GO:0003713 IEA:InterPro
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30651
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 105.70| 19| 60| 79| 97| 1
---------------------------------------------------------------------------
52- 66 (18.45/ 6.12) ...IYP...T.ATSQQDYLQKI
79- 97 (34.07/16.81) QNLIQP...NPASSRQNALGQG
110- 131 (26.35/11.53) QQLPVPtvaNQTQTRQPLLQQN
142- 160 (26.83/11.85) QNSASL...APALPSVSNLTQG
---------------------------------------------------------------------------
|