Description | Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASTSNPDTHESPQKSVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNPTFRNAMAHPANKEVAHRQQFYFWKNYRNNRLKHILPRPLPEPATAPSSAPPASLPSSVAPPAAPPLAPTPVTAAALSPMQYAIPPGSGLAKTDPRNASVDRRKRNRKDG |
Length | 201 |
Position | Middle |
Organism | Solanum tuberosum (Potato) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum. |
Aromaticity | 0.12 |
Grand average of hydropathy | -0.645 |
Instability index | 59.04 |
Isoelectric point | 9.41 |
Molecular weight | 22999.92 |
Publications | PubMed=21743474 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129 |
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP30649 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.56| 16| 18| 58| 73| 1 --------------------------------------------------------------------------- 34- 52 (23.45/12.73) FVQC...LanpTYIHYLAQNRY 58- 73 (32.73/20.16) FIGY...L...KYLQYWQRPEY 76- 94 (23.38/12.68) FIMYphcL...FFLELLQNPTF --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWKNYR 2) GLAKTDPR 3) VTAAALSPMQYAIPPG | 114 180 163 | 119 187 178 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab