<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30648
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MASTSNPDTHESPQKSVYKDPDDGRQRFLLELEFVQCLANPTYIHYLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFIMYPHCLFFLELLQNPTFRNAMAHPANKEVAHRQQFYFWKNYRNNRLKHILPRPLPEPATAPSSAPPASLPSSVAPPAAPPLAPTPVTAAALSPMQYAIPPGSGLAKTDPRNASVDRRKRKKDG |
| Length | 200 |
| Position | Middle |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.628 |
| Instability index | 58.67 |
| Isoelectric point | 9.39 |
| Molecular weight | 22857.80 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30648
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.56| 16| 18| 58| 73| 1
---------------------------------------------------------------------------
34- 52 (23.45/13.20) FVQC...LanpTYIHYLAQNRY
58- 73 (32.73/20.97) FIGY...L...KYLQYWQRPEY
76- 94 (23.38/13.15) FIMYphcL...FFLELLQNPTF
---------------------------------------------------------------------------
|