<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30624
| Description |
Uncharacterized protein |
| Sequence | MPILFPSARLSISCQPPSVLPAALSSLLPSNPVSVLHSSNGSNQTQRNPGSLLRTATSVAGKAKHVSSQQENDHEVDPWILLEDGAGSSNSSSNSPLVGGGDHANLKASNWLKGTVRVRRTDLTYIGAVDDDS |
| Length | 133 |
| Position | Kinase |
| Organism | Solanum tuberosum (Potato) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
asterids> lamiids> Solanales> Solanaceae> Solanoideae> Solaneae> Solanum.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.349 |
| Instability index | 50.13 |
| Isoelectric point | 6.39 |
| Molecular weight | 13912.24 |
| Publications | PubMed=21743474
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30624
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.76| 16| 28| 38| 53| 1
---------------------------------------------------------------------------
7- 20 (23.48/12.05) SARLSISCQ..PPSVL
38- 53 (28.22/15.68) SSNGSNQTQRNPGSLL
67- 82 (28.05/15.54) SSQQENDHEVDPWILL
---------------------------------------------------------------------------
|