<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30620
| Description |
Uncharacterized protein |
| Sequence | MRKKRSGGGMDATVDELSAAYKEFVAAAVAVMEAREQSGGQKTAATDTALEAFKQRWELFRVSCDHAEELVESIRQRIGSECLVDEATGSSSSSSAPASVALAAPGIKPISAVRLEQMSKAVRWLVIELQHGAGGPSAAGPGGGVSTPAAGAGGHHVHGGVESRFPEDGTQ |
| Length | 171 |
| Position | Tail |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.236 |
| Instability index | 60.63 |
| Isoelectric point | 5.74 |
| Molecular weight | 17586.42 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30620
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.64| 17| 19| 16| 34| 1
---------------------------------------------------------------------------
10- 31 (16.68/13.80) MDAtvdELSAAYKefVAAAVAV
32- 49 (24.96/13.41) MEA..rEQSGGQK..TAATDTA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.32| 18| 44| 89| 106| 2
---------------------------------------------------------------------------
89- 106 (29.39/12.85) GSSSSSSAPASVALAAPG
134- 151 (32.92/15.17) GGPSAAGPGGGVSTPAAG
---------------------------------------------------------------------------
|