<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30602
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MTGLEYVLSEVMEPHLFVMRKQKRSNSEKADPLLAYYILDGSIYQAPLLGSVFASRISRAMHHISKAFSTACSKLEKIGNAETEADAAASESKAQKETIDLKELKRVDHILMSLQRKLPPAPPPPPFPDGYVPTEQEKGPDDLLASEALPPAIDPIIDQGPAKRPRFQ |
| Length | 168 |
| Position | Head |
| Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.423 |
| Instability index | 63.45 |
| Isoelectric point | 6.10 |
| Molecular weight | 18549.10 |
| Publications | PubMed=23075845
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30602
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.16| 18| 30| 105| 124| 1
---------------------------------------------------------------------------
105- 124 (27.30/19.78) KRVDHILMSlQrKLPPAPPP
138- 155 (33.86/16.14) KGPDDLLAS.E.ALPPAIDP
---------------------------------------------------------------------------
|