<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30601
Description |
Uncharacterized protein |
Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKHKSSKTDEMGNGLS |
Length | 203 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.565 |
Instability index | 35.64 |
Isoelectric point | 9.43 |
Molecular weight | 23494.24 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30601
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.90| 17| 17| 133| 149| 1
---------------------------------------------------------------------------
133- 149 (31.82/ 9.60) KDKDKDREHKKHKHRHK
175- 191 (26.08/ 6.80) GTEDSADVHKHKKSKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.87| 16| 31| 117| 132| 2
---------------------------------------------------------------------------
117- 132 (28.60/11.45) KPKSESKDKEKKHKKH
151- 166 (27.27/10.59) RSKEKDKDKDKKKDKH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.84| 15| 19| 69| 87| 3
---------------------------------------------------------------------------
69- 87 (22.84/24.40) LVQNAYLRDKPayiqPFDM
90- 104 (26.00/16.14) LGQAFQLRETA....PVDL
---------------------------------------------------------------------------
|