<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30600
Description |
Uncharacterized protein |
Sequence | MDSDDKKFGKGPRELTGAVDLISQYKLQPHHDFFCKRPLPLAISDTHYLHNVVGDTEIRKGEGMELDQLVQNAYLRDKPAYIQPFDMETLGQAFQLRETAPVDLPSAEKGIPTISGKPKSESKDKEKKHKKHKDKDKDREHKKHKHRHKDRSKEKDKDKDKKKDKHHEKKRKHEGTEDSADVHKHKKSKVIYNYYLLPGTTNFLAAHFVGLLT |
Length | 213 |
Position | Head |
Organism | Hordeum vulgare subsp. vulgare (Domesticated barley) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Poales> Poaceae> BOP clade>
Pooideae> Triticodae> Triticeae> Hordeinae> Hordeum.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -1.293 |
Instability index | 31.51 |
Isoelectric point | 9.41 |
Molecular weight | 24704.76 |
Publications | PubMed=23075845
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP30600
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.28| 17| 17| 133| 149| 1
---------------------------------------------------------------------------
133- 149 (31.64/ 9.70) KDKDKDREHKKHKHRHK
153- 169 (30.35/ 9.08) KEKDKDKDKKKDKHHEK
170- 186 (26.28/ 7.09) KRKHEGTEDSADVHKHK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.54| 14| 18| 69| 86| 2
---------------------------------------------------------------------------
69- 86 (20.77/24.45) LVQNAYLRDKPayiqPFD
90- 103 (24.77/16.22) LGQAFQLRETA....PVD
---------------------------------------------------------------------------
|