<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30577
| Description |
Uncharacterized protein |
| Sequence | MAAKSKQELGVEGQRHLEETINAAFQILSSMNDELCNPVLWSTLSPGHPSAALAGAGDAPVDSSSHPSEAGGGSGGGVLDEARLRYKSAVLALRSCIAAIPSATQEAGALDSRADAVELERLEERASSLRKELENKNKHLKLLIDQLRDLITDIAMWQSPCSV |
| Length | 163 |
| Position | Head |
| Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.248 |
| Instability index | 56.69 |
| Isoelectric point | 5.08 |
| Molecular weight | 17287.25 |
| Publications | PubMed=22801500
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30577
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.28| 15| 16| 48| 62| 1
---------------------------------------------------------------------------
48- 62 (28.06/15.23) HPSAALAGAGDAPVD
66- 80 (29.22/16.11) HPSEAGGGSGGGVLD
---------------------------------------------------------------------------
|