<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30574
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MLIFFFAFLSLIKIMTPPQPCNSYDSDSPPSRSRSQLPPQRQSGAPSVVARSQLRAATAWGKSRGRKVLMATGTSSAYPPPPPYYRLYKDYLEDPESAPEPPPPVQGTYPLFGATYTTDVVLPSLEDQGVRQLYPKGPTIDFKRELTSLNRELQLHILELADVLVERPSQYARRVEDISLIFKNLHHLLNSLRPHQARATLIHILERQIQQRKQAIEDIKRRREEAQRLLKESLQNLDGHLA |
| Length | 242 |
| Position | Middle |
| Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.540 |
| Instability index | 75.27 |
| Isoelectric point | 9.54 |
| Molecular weight | 27586.26 |
| Publications | PubMed=22801500
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30574
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.11| 20| 23| 75| 94| 1
---------------------------------------------------------------------------
75- 94 (41.92/20.18) SSAYPPPP..PYYRLY.KDYLED
97- 119 (32.19/14.03) SAPEPPPPvqGTYPLFgATYTTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.47| 13| 15| 25| 37| 2
---------------------------------------------------------------------------
25- 37 (24.04/11.33) DSDSPPSRSRSQL
42- 54 (22.43/10.21) QSGAPSVVARSQL
---------------------------------------------------------------------------
|