<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30573

Description Uncharacterized protein
SequenceMAGKGDGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPINTVFDAKRLIGRRFTDASVQSDIKLWPFKVTSGPGDKPMIAVQYKGEEKQFSAEEISSMVLMKMKEIAEAYLGSVVKNAVVTVPAYFNDSQRQATKDAGVISGLNVMRIINEPTAAAIAYGLDKKASSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRMVNHFVQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGVDFYTTITRARFEELNMDLFRKCMDPVEKCLRDAKMDKSSVDDVVLVGGSTRIPKVQQLLQDFFNGKELCKSINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLIPRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQITVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYSYNMRNTIKDDKIASKLAAADKKKIEDAIDQAIQWLDGNQLAEADEFEDKMKELESICNPIIAKMYQGAGADMGGGMDDDAPSAGASGAGPKIEEVD
Length648
PositionUnknown
OrganismMusa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
Aromaticity0.06
Grand average of hydropathy-0.409
Instability index31.19
Isoelectric point5.09
Molecular weight70934.51
Publications
PubMed=22801500

Function

Annotated function 
GO - Cellular Component
cytoplasm	GO:0005737	IBA:GO_Central

GO - Biological Function
ATP binding	GO:0005524	IBA:GO_Central
ATPase activity	GO:0016887	IBA:GO_Central
heat shock protein binding	GO:0031072	IBA:GO_Central
misfolded protein binding	GO:0051787	IBA:GO_Central
protein folding chaperone	GO:0044183	IBA:GO_Central
unfolded protein binding	GO:0051082	IBA:GO_Central

GO - Biological Process
cellular response to unfolded protein	GO:0034620	IBA:GO_Central
chaperone cofactor-dependent protein refolding	GO:0051085	IBA:GO_Central
protein refolding	GO:0042026	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30573
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      76.00|      18|      21|      38|      55|       1
---------------------------------------------------------------------------
   16-   33 (19.07/ 9.64)	....TTYSCVGVWQHDRveIIA
   38-   55 (32.65/21.14)	NR..TTPSYVAFTDTER..LIG
   60-   78 (24.28/14.06)	NQvaMNPINTVF.DAKR..LIG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30573 with Med37 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KEDIEKMVQEAEKYKSEDEEHKKKVEAKNA
518
547










Molecular Recognition Features






MoRF SequenceStartStop




NANANA