<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30569
| Description |
Uncharacterized protein |
| Sequence | MSQGSICSIWTNSIHEILKRHLPFPEPVDSNILQNVAARLEEAIFNAAHNQSEYLRKISMKMLSVVSETQHSASINTSVSNNNNQNPTDPGTLFTGSDDSDETSGWSLAEGELSTAASGSSADWRTQLQPKARHMIVNQM |
| Length | 140 |
| Position | Tail |
| Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.513 |
| Instability index | 48.94 |
| Isoelectric point | 5.21 |
| Molecular weight | 15356.79 |
| Publications | PubMed=22801500
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | chromatin DNA binding GO:0031490 IBA:GO_Central
transcription coactivator activity GO:0003713 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30569
No repeats found
No repeats found
|