<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30563
Description |
Uncharacterized protein |
Sequence | MESKVESLSAAYDAFVLAAEARWEMFRVACDEAEAFIESMKQRIGSECLVDEATGAACLQPGHPDAAPGIPPISAVRLEQMSKAVRWLVIELQHGSGAASATASASAAAHSHASAPFDARSPEDAGQ |
Length | 127 |
Position | Tail |
Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.051 |
Instability index | 72.97 |
Isoelectric point | 4.73 |
Molecular weight | 13269.69 |
Publications | PubMed=22801500
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30563
No repeats found
|