<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30559
Description |
Uncharacterized protein |
Sequence | MLSDDRMYSKGKFGRGPRELTGAVDLIKHYKLSALHDFFCKRTLPSSISDTHYLHNVVGETEIRKGEGMELGQLFQSAPYLRETTSQIQQFDLEILGQAFQLRDTAPIDLPSSEKGIPTISGKSIGDSKGKERKHRKHKDKDREKDKEHKKHKHRHKDRTKDKDKEKKKDKSGRHDSGGDHSTKHHEKKRKHDGNEDSVDNHKHKKTKVVGVLVFSASLLLYDYICWFHLTKAILTSEIFQHKMSYCQTCWWRRIVRRISFHAPEFFELAIIHLFTLMVPLSYNFS |
Length | 286 |
Position | Head |
Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.899 |
Instability index | 42.04 |
Isoelectric point | 9.55 |
Molecular weight | 33348.67 |
Publications | PubMed=22801500
|
Function
Annotated function |
|
GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP30559
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 63.41| 15| 15| 137| 151| 1
---------------------------------------------------------------------------
131- 146 (23.52/ 9.55) KERKHrKHKDKDR..EKD
147- 164 (20.07/ 7.14) KEHKKhKHRHKDRtkDKD
165- 180 (19.82/ 6.97) KEKKKdKSGRHDS..GGD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.53| 19| 24| 62| 84| 2
---------------------------------------------------------------------------
62- 84 (28.45/39.08) EIRKGEGMELGQLFQsapyLRET
87- 105 (34.08/29.87) QIQQFDLEILGQAFQ....LRDT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.09| 10| 20| 185| 194| 3
---------------------------------------------------------------------------
185- 194 (19.86/ 9.86) HHEKKRKHDG
202- 211 (18.23/ 8.53) HKHKKTKVVG
---------------------------------------------------------------------------
|