<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30555
| Description |
Uncharacterized protein |
| Sequence | MAANFWTSSHYKQLLDPDKVDVVQRLDKEKGVTLEEFRLIKIHMSLQIWKLALQVKVRQRVIATAITYLRRVYTRKSMTEYDPRLVAPTCLYLASKVEESTVQARLLVFYIKKMYAGATSSDEKYRFEIKDILEMEMKVLEALDYYLVVFHPYRPLLQLLQDAGITDLTQVAWGLVNDTYKMDLILIHPPHMIALACIYIACVLKDKDLTTWFEELRVDMNIVKNISMEILEFFEYCRLDSKGNILIPEDRINAALNKVAAKP |
| Length | 263 |
| Position | Kinase |
| Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | 0.011 |
| Instability index | 42.47 |
| Isoelectric point | 7.63 |
| Molecular weight | 30675.76 |
| Publications | PubMed=22801500
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30555
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.48| 12| 105| 83| 94| 1
---------------------------------------------------------------------------
83- 94 (22.48/12.65) PRLVAPTCLYLA
190- 201 (22.99/13.06) PHMIALACIYIA
---------------------------------------------------------------------------
|