<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30532
Description |
Uncharacterized protein |
Sequence | MIPNQNPLNQDFHSLQPQYPPPPLLSQPQQQPQQQQQQHHHHPSLASHFHLLSLVERLADAIDSGGRDQQYEALVTELTNQFKRCQQLLDSISETISTKSLTVEGQKRRLEETMQQLNQRRDLVVKYRSHVEELVKPERNR |
Length | 141 |
Position | Middle |
Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -1.033 |
Instability index | 59.39 |
Isoelectric point | 6.70 |
Molecular weight | 16499.27 |
Publications | PubMed=22801500
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30532
No repeats found
|