<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30523
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MASGRDDADRPAESQTSSKNPYKDPDDGRQRFLLELEFVQCLSNPTYIHYLAQNRYFEDEAFIGYLKYLKYWQRPEYIKFIMYPHCLFFLELLQNANFRNAMAHPGSKELAHRQQYYFWKNYRNNRLKHILPRSLPEPPSVPASAPAPAPLPAGAPIPNAAPPPLPSMPPMTSAASALSPLQFVGQPGSAIPKSDIRNTMGDRRKRKKED |
Length | 210 |
Position | Middle |
Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.711 |
Instability index | 57.78 |
Isoelectric point | 9.37 |
Molecular weight | 23993.08 |
Publications | PubMed=22801500
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP30523
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.30| 24| 28| 136| 162| 1
---------------------------------------------------------------------------
132- 158 (43.62/20.60) PrslPEPPSVPASAPAPAPLP.AGAP...IP
162- 192 (32.68/ 8.95) PpplPSMPPMTSAASALSPLQfVGQPgsaIP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.30| 20| 27| 32| 51| 2
---------------------------------------------------------------------------
32- 51 (36.14/21.97) FLLELEFVQCLSNPTYIHYL
62- 81 (38.16/23.53) FIGYLKYLKYWQRPEYIKFI
---------------------------------------------------------------------------
|