<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30516
| Description |
Uncharacterized protein |
| Sequence | MDPESKKFGRGPRELTGAADLINRYKLSAHHDFFCKRILPLSISDTHYLHNVVGDTEIRKGEGMELGQLFQSAPYLRETTAQIQQFNLDLLGQAFELRDTAPIDLPLSEKGTPTIPGKSKGDSKDKGRKHKKHKVKDREKDKEHKKHKRRHKDRSKDKDREKKKDKSGHHDSGGDHSKKHHEKKRKHDGNEDSVDNHKHKKSKVVGMV |
| Length | 208 |
| Position | Head |
| Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.443 |
| Instability index | 35.02 |
| Isoelectric point | 9.75 |
| Molecular weight | 23909.72 |
| Publications | PubMed=22801500
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP30516
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.45| 15| 15| 137| 151| 1
---------------------------------------------------------------------------
137- 151 (29.00/10.66) DREKDKEHKKHKRRH
153- 167 (23.45/ 7.32) DRSKDKDREKKKDKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.10| 15| 51| 119| 133| 2
---------------------------------------------------------------------------
119- 133 (29.32/13.11) SKGD.SKDKGRKHKKH
172- 187 (23.78/ 9.31) SGGDhSKKHHEKKRKH
---------------------------------------------------------------------------
|