| Description | Uncharacterized protein |
| Sequence | MATVKASEERGDPPLLRAVEAARCVQEAGLGLPNPELAHVLVSNLCFANNTPSMWKLLDQAMSCRVVSPIHTLALLKPRHGSDPFRVIPRRWAQPEAYRLYLDLVSRYAVSSLSIEAGGSCRDNIAFGIYLSRI |
| Length | 134 |
| Position | Tail |
| Organism | Musa acuminata subsp. malaccensis (Wild banana) (Musa malaccensis) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> Liliopsida> Zingiberales> Musaceae> Musa. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | 0.014 |
| Instability index | 52.28 |
| Isoelectric point | 8.82 |
| Molecular weight | 14773.96 |
| Publications | PubMed=22801500 |
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process | regulation of phenylpropanoid metabolic process GO:2000762 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP30504 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) FRVIP 2) YRLYLD | 85 98 | 89 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab