Description | Mediator of RNA polymerase II transcription subunit 29 (Fragment) |
Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLVRSLLDTGAWRMSACHRVVTVPSTLQRWCPQPPSPTQCSLTASPTHSTWRSSKPRFPVPRTFTPPCWTVPTRSRARHPHHLLALGALC |
Length | 208 |
Position | Tail |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae> Homo. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.438 |
Instability index | 76.36 |
Isoelectric point | 9.20 |
Molecular weight | 22660.58 |
Publications | PubMed=15057824 PubMed=19413330 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP30501 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 70.64| 21| 115| 26| 46| 1 --------------------------------------------------------------------------- 5- 28 (31.49/16.76) QQQasaASSAAGVSGPSSAGGPGP 29- 49 (39.16/22.79) QQQ...PQPPAQLVGPAQSGLLQQ --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 101.67| 25| 37| 130| 154| 2 --------------------------------------------------------------------------- 130- 154 (50.78/26.70) WRMSACHRVVTVPSTLQRWCPQPPS 169- 193 (50.89/26.78) WRSSKPRFPVPRTFTPPCWTVPTRS --------------------------------------------------------------------------- |
Disease |
MoRF Sequence | Start | Stop |
1) MAASQQQASAASS 2) RYKMLI | 1 59 | 13 64 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab