<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30498
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQVSLCHPGWTTVARSWLIAALNT |
| Length | 114 |
| Position | Tail |
| Organism | Homo sapiens (Human) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.328 |
| Instability index | 67.02 |
| Isoelectric point | 7.94 |
| Molecular weight | 11945.32 |
| Publications | PubMed=15057824
PubMed=19413330
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP30498
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.00| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (38.84/15.17) GPSSAGGPGPQQQPQPPAQ
40- 58 (35.16/13.14) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|
Associated diseases