<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30495
Description |
Mediator of RNA polymerase II transcription subunit 25 (Fragment) |
Sequence | KKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQQRGMGGQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASGATGQPQPQGTAQPPPGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPAAKRKREGEGRVFREKWERAYFFVEVKSMPMCLICKQIVSVLKEYNLKRHYESKHSKSYDQYTEQTRDAILNELKKGLKCQ |
Length | 278 |
Position | Unknown |
Organism | Homo sapiens (Human) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Hominidae>
Homo.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.781 |
Instability index | 69.11 |
Isoelectric point | 10.01 |
Molecular weight | 30220.38 |
Publications | PubMed=15057824
|
Function
Annotated function |
|
GO - Cellular Component | nucleoplasm GO:0005654 IDA:HPA
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30495
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 85.88| 22| 23| 79| 101| 1
---------------------------------------------------------------------------
79- 100 (46.23/10.96) GASGATGQPQPQGTAQ..PPPGAP
135- 158 (39.65/ 6.04) PPPPQTGVPPPQASLHhlQPPGAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.56| 21| 49| 51| 75| 2
---------------------------------------------------------------------------
29- 71 (18.27/ 8.24) VQQqkleqqqrgmggqqappglGPiLEDQARPSQnlLQLRPPQ
165- 196 (31.29/ 6.55) HQG........lgqpqlgppllHP.PPAQSWPAQ..LPPRAPL
---------------------------------------------------------------------------
|
Associated diseases