<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30480
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAAVEPNSTPMRTANRARFELELEFVQALANPFYLENLASEGLLEDQAFINYLQYLQYWRKSEYSYKMFGFGRYPHCLHFLELLQHEQFRNELKNPLTRMRLEHYQFEHWRTWRSGPPPPAPVDEQQPVDEAKTPAPTHPPTTPGPGQTSATPGPGRGSATPGPGRGSATPAISRRGSLHPGASVPIAGLNGGFAQMQSEHDCTLLLTHDYANNQESIKACPKHRDLNESFFTIYWVATEVRTKYDQKRRISDLLFEKFRKSANEGTSAQSTLIGTELCAMMPSSSGQDVMYETQLGAAHMCHGVVV |
| Length | 307 |
| Position | Middle |
| Organism | Thanatephorus cucumeris (strain AG1-IA) (Rice sheath blight fungus) (Rhizoctonia solani) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Cantharellales> Ceratobasidiaceae> Rhizoctonia> Rhizoctonia solani AG-1.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.592 |
| Instability index | 45.44 |
| Isoelectric point | 6.46 |
| Molecular weight | 34443.36 |
| Publications | PubMed=23361014
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.48| 17| 17| 143| 159| 1
---------------------------------------------------------------------------
128- 141 (20.71/ 7.53) ...PVDEAKTPAPTH.PP
143- 159 (36.00/17.64) TPGPGQTSATPGPGR.GS
161- 178 (29.77/13.52) TPGPGRGSATPAISRrGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 32.16| 13| 20| 17| 36| 2
---------------------------------------------------------------------------
17- 31 (11.55/ 9.58) ARfELELEfVQALAN
39- 51 (20.61/16.19) AS.EGLLE.DQAFIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.48| 16| 20| 81| 96| 3
---------------------------------------------------------------------------
81- 96 (28.41/17.71) LELLQHEQFRNELKNP
102- 117 (34.07/22.57) LEHYQFEHWRTWRSGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.67| 14| 20| 190| 203| 4
---------------------------------------------------------------------------
190- 203 (27.21/18.58) LNGGFAQMQ.SEHDC
207- 221 (21.46/13.32) LTHDYANNQeSIKAC
---------------------------------------------------------------------------
|