<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30480

Description Mediator of RNA polymerase II transcription subunit 31
SequenceMAAVEPNSTPMRTANRARFELELEFVQALANPFYLENLASEGLLEDQAFINYLQYLQYWRKSEYSYKMFGFGRYPHCLHFLELLQHEQFRNELKNPLTRMRLEHYQFEHWRTWRSGPPPPAPVDEQQPVDEAKTPAPTHPPTTPGPGQTSATPGPGRGSATPGPGRGSATPAISRRGSLHPGASVPIAGLNGGFAQMQSEHDCTLLLTHDYANNQESIKACPKHRDLNESFFTIYWVATEVRTKYDQKRRISDLLFEKFRKSANEGTSAQSTLIGTELCAMMPSSSGQDVMYETQLGAAHMCHGVVV
Length307
PositionMiddle
OrganismThanatephorus cucumeris (strain AG1-IA) (Rice sheath blight fungus) (Rhizoctonia solani)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes> Cantharellales> Ceratobasidiaceae> Rhizoctonia> Rhizoctonia solani AG-1.
Aromaticity0.10
Grand average of hydropathy-0.592
Instability index45.44
Isoelectric point6.46
Molecular weight34443.36
Publications
PubMed=23361014

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364129
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP30480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.48|      17|      17|     143|     159|       1
---------------------------------------------------------------------------
  128-  141 (20.71/ 7.53)	...PVDEAKTPAPTH.PP
  143-  159 (36.00/17.64)	TPGPGQTSATPGPGR.GS
  161-  178 (29.77/13.52)	TPGPGRGSATPAISRrGS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.16|      13|      20|      17|      36|       2
---------------------------------------------------------------------------
   17-   31 (11.55/ 9.58)	ARfELELEfVQALAN
   39-   51 (20.61/16.19)	AS.EGLLE.DQAFIN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.48|      16|      20|      81|      96|       3
---------------------------------------------------------------------------
   81-   96 (28.41/17.71)	LELLQHEQFRNELKNP
  102-  117 (34.07/22.57)	LEHYQFEHWRTWRSGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.67|      14|      20|     190|     203|       4
---------------------------------------------------------------------------
  190-  203 (27.21/18.58)	LNGGFAQMQ.SEHDC
  207-  221 (21.46/13.32)	LTHDYANNQeSIKAC
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30480 with Med31 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) WRSGPPPPAPVDEQQPVDEAKTPAPTHPPTTPGPGQTSATPGPGRGSATPGPGRGSATPAISRRGSLHPGASVPIAGLNGGF
113
194










Molecular Recognition Features






MoRF SequenceStartStop




NANANA