<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30476
Description |
Med21 domain-containing protein |
Sequence | MGPRHCTSVILELACSDNLVEAAFLVCGTSGVPAATPQSKIEFERTAARGKCPSCTRSSPRTWTNLPSYMTRSNQYALLVIMSNSVVYLVTRNSFRQVNPDIPITKTRPPDKEDSPDVFEANKRELVNDLITKAKQIEYLIKSLPPPEPESEQACTSAAGCGCKVGLTRSGDETSKRGVSAGAGSCATIAYSGWGGVGTYAQ |
Length | 202 |
Position | Middle |
Organism | Thanatephorus cucumeris (strain AG1-IA) (Rice sheath blight fungus) (Rhizoctonia solani) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Cantharellales> Ceratobasidiaceae> Rhizoctonia> Rhizoctonia solani AG-1.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.295 |
Instability index | 64.57 |
Isoelectric point | 8.36 |
Molecular weight | 21626.30 |
Publications | PubMed=23361014
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30476
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.38| 12| 14| 91| 102| 1
---------------------------------------------------------------------------
91- 102 (21.81/13.44) TRNSFRQVNPDI
107- 118 (22.57/14.12) TRPPDKEDSPDV
---------------------------------------------------------------------------
|