<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30468
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | METRAAPVAASSPVASSASAVVREQLQQYARLASALLHSLLPSSATSTTPGPSSSSVASSGDRSAAALQKNASPEELMERLLRTDQALLRALNQLREHQRQQQRLARLKDEVAKKDGVVEQLALQLQQAQGTLQRVIDDTTTKLDRPLVPGGGSARRDGVDVDEVVAYAHKVSYTTSAPPNWNPNLPHMRMFLPPAPQEINILQGNFYHNSTSAPIPDFSDLTGAAKKEEADLGAPDLGAGPTLPMQQPLPFAGGPAPALIPIAELPPAPPSGLAPPPSEPVKQIMLDLNPDDEDSDSSSDLDDDEDDWV |
| Length | 310 |
| Position | Middle |
| Organism | Acanthamoeba castellanii str. Neff |
| Kingdom | Amoebozoa |
| Lineage | Eukaryota> Amoebozoa> Discosea> Longamoebia> Centramoebida>
Acanthamoebidae> Acanthamoeba.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.454 |
| Instability index | 64.49 |
| Isoelectric point | 4.65 |
| Molecular weight | 32983.42 |
| Publications | PubMed=23375108
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30468
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 136.59| 31| 33| 212| 242| 2
---------------------------------------------------------------------------
176- 211 (43.40/19.55) T...SAPpnwNPNLPHMRMflPPAPQEINI.LQGNFYHNS
212- 242 (51.17/24.32) T...SAP...IPDFSDLTG..AAKKEEADL.GAPDLGAGP
243- 276 (42.01/18.70) TlpmQQP...LP.FAGGPA..PALIPIAELpPAPPSGLAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.59| 19| 26| 93| 111| 4
---------------------------------------------------------------------------
93- 111 (32.61/23.28) NQLR.EHQRQQQRLARLKDE
120- 139 (26.98/18.03) EQLAlQLQQAQGTLQRVIDD
---------------------------------------------------------------------------
|