<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30461
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MATRALDPPLDEIQWRSPAWAQQMMGIHSNSVLPYFAKSPFFDPTSNNAVLENQAMYNQNMVNIVATREAFEGRLKTMSGLEYVVAQEPAETAPGTGTGVWVIRKQTRRKRQGQEDDITIHSTYFVMGENIYMAPAFLDVVRSRMLSIFTSLDKFVSAANALPNFTPLSGHTYLPPVAARPKATDSQLATQTSRQSSPLSDSAGGSRKQVAGTTSTYMDARLLDESFQLSMRYGDEYMDENPITGHPGAFNLTSTGRKTKDTLGAAAQKAGLQDPSKIGASPVDEKASDIPPTRKSSKAADKAPRTPGIPKPKRKKSKVLSASGIAPV |
Length | 328 |
Position | Head |
Organism | Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.494 |
Instability index | 47.99 |
Isoelectric point | 9.50 |
Molecular weight | 35629.91 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30461
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.20| 17| 17| 281| 297| 2
---------------------------------------------------------------------------
268- 284 (26.83/11.07) QKAGLQDPSKIGASPVD
285- 301 (28.37/12.01) EKASDIPPTRKSSKAAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 127.21| 40| 82| 106| 148| 3
---------------------------------------------------------------------------
106- 148 (62.95/50.51) QTRRKRQGQEDDITiHSTYFVMG.ENIYMAPAFLDvvRSRMLSI
191- 231 (64.26/41.18) QTSRQSSPLSDSAG.GSRKQVAGtTSTYMDARLLD..ESFQLSM
---------------------------------------------------------------------------
|