<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30460
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MADQQQGNVQALAFPSPPPFYQHFTEENLARVSVLRAGRESDSSQKDDSPKEPELQGDLQYLQPPEPPAEGTYRSFGDIYNLNDILPSLTEQGIEQLYSPPATPSGSSAGPDKQSHSDRTLILKRIAKSLLLNFLELMGIMSVNPEQYAEKIQDLRTLFINFHHLLNEYRPHQARESLILMMEAQLARSKAETNGIESMKTKVEGILAGLGQVNIAPEEAEEYKDTKKDLEEYDGAKDVWDELHREYGLVEPVISS |
| Length | 256 |
| Position | Middle |
| Organism | Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.642 |
| Instability index | 66.24 |
| Isoelectric point | 4.71 |
| Molecular weight | 28755.80 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30460
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 111.77| 21| 33| 56| 77| 1
---------------------------------------------------------------------------
6- 25 (38.93/17.15) QGNVQALAFPSPPP..FYQHFT
56- 77 (38.49/20.41) QGDLQYLQPPEPPAeGTYRSFG
92- 110 (34.35/14.47) QGIEQLYSPPATPS.GS..SAG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.08| 21| 25| 128| 150| 2
---------------------------------------------------------------------------
128- 150 (30.99/31.11) KSLLLNFLELMGimSVNPEQYAE
156- 176 (39.09/30.53) RTLFINFHHLLN..EYRPHQARE
---------------------------------------------------------------------------
|