Description | Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MHELFLTAAVPGEHVKEALKILQGLCAMPPAHKYQRVLTYEGPSAQLVPIPAARVQNRRPQDREVWNELNKQLVRQSHYITLAFAAERGEFSGGAEDQAGEKPVIDLEEARGTLHFYDYPEPPHPSRPVNSRLVIHIPDEPKLPSLLRSIKFTHYSESLREIYNFYRDNVTFTLSRELQRKQQDGVIDLEGSTPQASSDIRDYIPFDGENKWVLKASVEVTDEKEGPLVQRGIEELLKVQSDLAGLYEFSILDRAVLDTRVPAFLEQLRRR |
Length | 271 |
Position | Head |
Organism | Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.529 |
Instability index | 63.90 |
Isoelectric point | 5.69 |
Molecular weight | 30979.68 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30457 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 285.57| 81| 81| 84| 164| 1 --------------------------------------------------------------------------- 40- 108 (85.23/43.68) ..........YEGPsaqlvPIPAARVQNRR....PQDREVWNELNKqlV.RQSHYI.TL....AFAAERGEFSGGAEDQAGEK.PVIDLE 109- 190 (135.10/72.77) EARGTLHFYDYPEP.....PHPSRPVNSRLVIHIPDEPKLPSLLRS..I.KFTHYSESLREIYNFYRDNVTFTLSRELQRKQQdGVIDLE 193- 248 (65.24/32.01) TPQASSDIRDYIPF.....DGENKWV.LKASVEVTDEKEGPLVQRG..IeELLKVQSDLAGLYE.......................... --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
NA | NA | NA |
MoRF Sequence | Start | Stop |
1) RLVIHI 2) TLHFYDYP | 132 113 | 137 120 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab