| Description | Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MTSLNSDEMRAIDQTRTRLDQLTKSIGALKNDILRSPVMPPIDSIQVHSTILAQSLKNITNHLCKHSDLFSQTVVYPSTNFPGRTQEGLVGQLLRKKLEPSAESWVEEGRALGKTENVGGGQDENLDELWSFAKEYVLPQVAKAAQLSRSSLDDIYAESDEEEEEAEEEGEEEGGEKKHAYGDGGSRNPAGISRDLNAITRFMTTGTATGN |
| Length | 211 |
| Position | Head |
| Organism | Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes> Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.696 |
| Instability index | 53.33 |
| Isoelectric point | 4.73 |
| Molecular weight | 23152.27 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP30455
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.10| 29| 52| 92| 120| 1
---------------------------------------------------------------------------
92- 120 (50.90/34.80) QLLRKKLEP.SAESWVEEGRALGKTENVGG
146- 175 (45.20/30.08) QLSRSSLDDiYAESDEEEEEAEEEGEEEGG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) EGGEKKHAYGD 2) LDDIYAE 3) NPAGISRDLNAITRFMTTGTATGN | 173 152 188 | 183 158 211 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab