<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30449
Description |
Uncharacterized protein |
Sequence | MSNDRRSPSRSASADQTANEASQAVIANDGDVTHVAPLSPPAPLPSSLNTRTGPSTNELMEREQGIVDAMLLRFKNIIELATTNKGDVTSEVAAAQAFQTNVETQALIRAAQDLLSLTREMKELWLFGPLRGLGEGEEGGSIDDNSKRVVEMVEAMIQERTGREM |
Length | 165 |
Position | Head |
Organism | Pseudogymnoascus destructans (strain ATCC MYA-4855 / 20631-21) (Bat white-nose syndrome fungus) (Geomyces destructans) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Leotiomycetes>
Leotiomycetes incertae sedis> Pseudeurotiaceae> Pseudogymnoascus.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.442 |
Instability index | 48.69 |
Isoelectric point | 4.65 |
Molecular weight | 17838.74 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP30449
No repeats found
|