<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30435
Description |
Mediator of RNA polymerase II transcription subunit 29 |
Sequence | MAASQQASAPSSAAGVSGPGSAGGPGTQQQPQPPTQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLDCANKVTGKTPAPPTGPGGAL |
Length | 199 |
Position | Tail |
Organism | Pteropus alecto (Black flying fox) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Chiroptera> Megachiroptera> Pteropodidae>
Pteropodinae> Pteropus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.360 |
Instability index | 64.52 |
Isoelectric point | 5.86 |
Molecular weight | 20958.54 |
Publications | PubMed=23258410
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP30435
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.33| 19| 20| 18| 36| 1
---------------------------------------------------------------------------
18- 36 (38.47/17.31) GPGSAGGPGTQQQPQPPTQ
39- 57 (34.87/15.04) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|