<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30433
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPIAVTAPPGADKAAGCGPFYLMRELPGNTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 243 |
| Position | Head |
| Organism | Pteropus alecto (Black flying fox) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Chiroptera> Megachiroptera> Pteropodidae>
Pteropodinae> Pteropus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.996 |
| Instability index | 63.01 |
| Isoelectric point | 9.83 |
| Molecular weight | 26255.84 |
| Publications | PubMed=23258410
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP30433
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.91| 16| 17| 189| 204| 1
---------------------------------------------------------------------------
169- 182 (25.73/ 9.79) P..PKKKNKHKHKQSR
189- 204 (27.40/10.82) PETPSDSDHKKKKKKK
208- 223 (26.77/10.43) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 113.06| 21| 114| 109| 129| 2
---------------------------------------------------------------------------
69- 82 (20.09/ 7.74) .ELPGNTE......LTGSTN......L
109- 129 (41.95/23.64) PDLPGMID......LPGSHDNSSLRSL
134- 153 (17.95/ 6.18) PILGGSFNpitgtmLAG......FR.L
226- 242 (33.06/17.17) PDHPGM..........GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.30| 27| 27| 9| 35| 3
---------------------------------------------------------------------------
9- 35 (57.59/15.86) GAQADPPPPPTALGFGPGKPPPPPPPP
37- 63 (52.71/13.98) GGGPGTAPPPIAVTAPPGADKAAGCGP
---------------------------------------------------------------------------
|