Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPIAVTAPPGADKAAGCGPFYLMRELPGNTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 243 |
Position | Head |
Organism | Pteropus alecto (Black flying fox) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Megachiroptera> Pteropodidae> Pteropodinae> Pteropus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.996 |
Instability index | 63.01 |
Isoelectric point | 9.83 |
Molecular weight | 26255.84 |
Publications | PubMed=23258410 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30433 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.91| 16| 17| 189| 204| 1 --------------------------------------------------------------------------- 169- 182 (25.73/ 9.79) P..PKKKNKHKHKQSR 189- 204 (27.40/10.82) PETPSDSDHKKKKKKK 208- 223 (26.77/10.43) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 113.06| 21| 114| 109| 129| 2 --------------------------------------------------------------------------- 69- 82 (20.09/ 7.74) .ELPGNTE......LTGSTN......L 109- 129 (41.95/23.64) PDLPGMID......LPGSHDNSSLRSL 134- 153 (17.95/ 6.18) PILGGSFNpitgtmLAG......FR.L 226- 242 (33.06/17.17) PDHPGM..........GSSQASSSSSL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 110.30| 27| 27| 9| 35| 3 --------------------------------------------------------------------------- 9- 35 (57.59/15.86) GAQADPPPPPTALGFGPGKPPPPPPPP 37- 63 (52.71/13.98) GGGPGTAPPPIAVTAPPGADKAAGCGP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) MENFTAL 2) SDHKKKKKKKEEDPERKRKKKEKKKKKNRHSP | 1 195 | 7 226 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab