<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30422

Description Cytosol aminopeptidase
SequenceMFLLPLPAVGRVAVRHLGLKRVWSQGLATAAMTKGLVLGIYNREKENDVPQLTSAGENFDKLVSGKLREVLNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKAAGVDEQENWHEGKENIRVAIAAGCRQVQDLEISSVEVDPCGDAQAAAEGAVLGLYEYDDMKQKKKVAVSAKLYGSGDQEAWHRGVLFASGQNLARQLMETPANEMTPTRFAEIIEKNLRGASSKTEVHIRPKSWIVEQEMGSFLSVAKGSDEPPVFLEVHYKGSPNASEPPLVFVGKGITFDSGGISIKPSANMDLMRADMGGAATICSAIVSAAKLDLPINVIGLAPLCENMPSGKASKPGDVVTAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKAIINAATLTGAMDIALGSAATGVFTNSSWLWNKLFEASVETGDRVWRMPLFEHYTRQVVDCQLADVNNVGKYRSGGACTXXXXACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDVSAQHKKPADIPQGSLAYLEQASANIPAPMKQT
Length592
PositionHead
OrganismPteropus alecto (Black flying fox)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Megachiroptera> Pteropodidae> Pteropodinae> Pteropus.
Aromaticity0.06
Grand average of hydropathy-0.223
Instability index37.52
Isoelectric point6.31
Molecular weight63914.25
Publications
PubMed=23258410

Function

Annotated function
GO - Cellular Component
cytoplasm	GO:0005737	IEA:InterPro
GO - Biological Function
carboxypeptidase activity	GO:0004180	IEA:RHEA
manganese ion binding	GO:0030145	IEA:InterPro
metalloaminopeptidase activity	GO:0070006	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP30422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.54|      20|      69|     104|     128|       1
---------------------------------------------------------------------------
  104-  128 (31.41/28.84)	KAAGVDEQENWHEGkenirVAIAAG
  176-  195 (39.12/23.50)	KLYGSGDQEAWHRG.....VLFASG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.69|      11|      16|     287|     297|       3
---------------------------------------------------------------------------
  287-  297 (19.84/12.36)	DSGGISIKPSA
  305-  315 (20.86/13.38)	DMGGAATICSA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.84|      18|      30|     509|     527|       5
---------------------------------------------------------------------------
  509-  527 (24.72/22.70)	FLQKRLQlSVQKPEQVIKE
  542-  559 (31.12/23.16)	LVQKHLT.KLRHWQQVLED
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP30422 with Med28 domain of Kingdom Metazoa

Unable to open file!