Description | Mediator of RNA polymerase II transcription subunit 22 |
Sequence | MAQQRALPQSKETLLQSYNKRLKDDVKSIMDNFAEIIKTTKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRALQEECDRKLIALRDEVSIDLYELEEEYYSSRYK |
Length | 140 |
Position | Head |
Organism | Pteropus alecto (Black flying fox) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Megachiroptera> Pteropodidae> Pteropodinae> Pteropus. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.747 |
Instability index | 63.86 |
Isoelectric point | 4.93 |
Molecular weight | 16391.27 |
Publications | PubMed=23258410 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP30421 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KIEDETQVSRAT 2) YEMHV 3) YNKRLK | 41 59 18 | 52 63 23 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab