<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP30419

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAPVQLENHQLVPPGGGGGGSGGSASAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADERPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLSVWNQQVLGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLMLYGLDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISTDTLQLSNYSTHPIGKLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYKYYFMSVSAADREDSPVMALLLQQFKENIQELIFRTKTGKHPRTSTKRKLSDDSCPVEPKKTKRSEETCAFNKILAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQMEGDGFSHAIRLLKIPPCKGINEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPTHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMYVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFPKQPGSSGAYPLTSPPTSYHSTVSPSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRLPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFAAVRDLMANLTLPPGGRP
Length1454
PositionTail
OrganismPteropus alecto (Black flying fox)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Chiroptera> Megachiroptera> Pteropodidae> Pteropodinae> Pteropus.
Aromaticity0.07
Grand average of hydropathy-0.192
Instability index52.95
Isoelectric point8.97
Molecular weight160777.82
Publications
PubMed=23258410

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP30419
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     184.81|      28|      31|    1033|    1062|       1
---------------------------------------------------------------------------
 1002- 1033 (39.05/14.92)	PPPQ....QQPFPKQPG...SSGAYPL..TSP.....PtsyhstvS
 1034- 1070 (43.39/22.73)	PSPSmmHTQSPGNLHAA...SSPSGAL..RAP..S..PasfvptpP
 1071- 1101 (40.80/15.92)	PSS...HGISIGPGASF...ASPHGTL..DPS..S..P...ytmvS
 1102- 1129 (26.93/ 7.99)	PSG......RAGNWPGSpqvSGPSPAT..RLPgmS..P........
 1132- 1160 (34.64/12.40)	PSL...H..SPVPDASH...SPRAGTSsqTMP..TnmP.......P
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.10|      29|      32|     272|     303|       3
---------------------------------------------------------------------------
  272-  303 (45.21/47.83)	NFIHQlvQSRLFADERpLQDMYNC..LHS.FCLSL
  306-  337 (42.89/31.61)	EVLHS..QTLMLIRER.WGDLVQVerYHAgKCLSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.03|      24|      30|    1326|    1351|       4
---------------------------------------------------------------------------
 1326- 1351 (43.68/31.66)	PdqATQLKWNVQFC..LTIPPSAPPIAP
 1355- 1380 (39.36/21.85)	P..AVVLKSKMLFFlqLTQKTSVPPQEP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      66.16|      21|      30|    1226|    1248|       5
---------------------------------------------------------------------------
 1226- 1248 (31.81/26.59)	QETLQL.INSNEPGviMFKTDALK
 1258- 1279 (34.34/21.89)	NQTLQLkVTPENAG..QWKPDELQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.27|      32|      32|      66|      97|       6
---------------------------------------------------------------------------
   66-   97 (51.36/37.81)	LMVLTDLLPRKSDVERKIEIVQFASRTRQLFV
   99-  130 (52.92/39.20)	LLALVKWANNAGKVEKCAMISSFLDQQAILFV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.59|      29|     158|     340|     370|       7
---------------------------------------------------------------------------
  340-  370 (40.03/39.15)	WNQQVLGrKTGTASVHKvTIKIDENDVSKPL
  373-  401 (48.56/35.80)	FHDPPLP.ASDSKLVER.AMKIDHLSIEKLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.30|      11|      37|     207|     217|       8
---------------------------------------------------------------------------
  207-  217 (19.25/11.56)	DLPPQLANLTV
  242-  252 (20.05/12.43)	DVPWRLLKLEI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.10|      11|      36|     135|     145|       9
---------------------------------------------------------------------------
  135-  145 (16.90/ 8.59)	RLASLARDALV
  168-  178 (20.20/11.70)	RLPTCIRDKII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.39|      18|      36|     511|     528|      10
---------------------------------------------------------------------------
  511-  528 (31.63/19.08)	HLPT..ISTDTLQLSNYSTH
  544-  563 (26.76/14.95)	RLPQyyIVVEMLEVPNKPTQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.33|      10|      24|    1402|    1411|      11
---------------------------------------------------------------------------
 1402- 1411 (17.56/ 8.88)	PRQQNSSVAA
 1428- 1437 (19.77/10.87)	PRQGECTIFA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP30419 with Med14 domain of Kingdom Metazoa
Unable to open file!